PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P30660_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bHLH
Protein Properties Length: 85aa    MW: 9706.11 Da    PI: 7.366
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P30660_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH19.22.2e-0612511554
                           HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                    HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                           +i++ +++Lr llP+  ++++ +   a  L+++++YI sL
  GSMUA_Achr6P30660_001 12 EIKELISKLRFLLPETRRQGGSRALAAKLLQETCNYIESL 51
                           799************66899999999************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508888.905151IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.5E-71170IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474596.38E-71174IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
MSGRRSRISE EEIKELISKL RFLLPETRRQ GGSRALAAKL LQETCNYIES LHRDVDDLSD  60
RLTELMATMD ISSAQAEIVR SLLRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406651.15e-54PREDICTED: transcription factor ILI5-like
SwissprotA2X9L83e-33ILI5_ORYSI; Transcription factor ILI5
SwissprotQ6YUX03e-33ILI5_ORYSJ; Transcription factor ILI5
TrEMBLM0TBL16e-54M0TBL1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P30660_0012e-53(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26753378
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.13e-23bHLH family protein